The Whippled Life Ranch Friends

thewhippledliferanchfriends.com
Wow did life whipple my family around and teach us so many new ways of living. Nature mixed with sickness and disease sure makes for a believer in the universal unity of all things. This website is just the story of my life and what I have learned works for some people. From How the Body Works Best to Blogs About Me.

The Whippled Life Ranch Friends is an e-commerce website that was registered on June 9, 2021. The store is hosted on the Shopify platform under the account name thewhippledliferanchfriends.myshopify.com. The publicly registered domain name for this store is thewhippledliferanchfriends.com.

The store collects payments in the USD currency, and uses the English language setting for its website.

It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.

Note: This website, Merchant Genius, is not affiliated with The Whippled Life Ranch Friends. Please contact the store owner directly for any issues or questions pertaining to the online store.