Desert sweets and pickle is an e-commerce website that was registered on October 4, 2022. The store is hosted on the Shopify platform under the account name desertsweetanddesipickle.myshopify.com. The publicly registered domain name for this store is rajpic.com.
The store collects payments in the INR currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with Desert sweets and pickle. Please contact the store owner directly for any issues or questions pertaining to the online store.
The store collects payments in the INR currency, and uses the English language setting for its website.
It does not appear that the store owner has provided a contact email address. We recommend visiting the website directly for further details. You can also check out our FAQ for additional information.
Note: This website, Merchant Genius, is not affiliated with Desert sweets and pickle. Please contact the store owner directly for any issues or questions pertaining to the online store.
Sponsored Content
Shop Preview
General Information on Desert sweets and pickle
This store is hosted on Shopify
The store was registered on October 4, 2022
The store language setting is English
The store currency setting is INR
Contact Information for Desert sweets and pickle
rajpic.comdesertsweetanddesipickle.myshopify.com
No Email Information Found 
No Phone Information Found
